PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03206.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 366aa    MW: 41689.4 Da    PI: 6.4511
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03206.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEd++l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Rsa1.0_03206.1_g00004.1 14 RGLWSPEEDDKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                             788*******************************************97 PP

2Myb_DNA-binding51.52.3e-1667111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr+++eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
  Rsa1.0_03206.1_g00004.1  67 RGRFSPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                              89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.793961IPR017930Myb domain
SuperFamilySSF466892.1E-2911108IPR009057Homeodomain-like
SMARTSM007174.5E-121363IPR001005SANT/Myb domain
PfamPF002495.1E-151461IPR001005SANT/Myb domain
CDDcd001676.49E-111761No hitNo description
PROSITE profilePS5129425.2762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-2565116IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.3E-1567111IPR001005SANT/Myb domain
CDDcd001671.68E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDDKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPH  120
HHYNRHQPSI TTVTMNVDAT STVTAVPSNT TTSTIDSLHF DSFMDCPNQL NFSNDQETNK  180
KIQETLSSHK TPLFMVDPTL PVLEGMFSQN IITNKNHDHE TQRGGRGSVF EQSFLTNTME  240
EWDINLRQQE PFQVPTMVSH LFNNSTNSNT ETAISYINIP ALVEGNVDNI SPIDNSTQDG  300
DMASAFESLK KQEQSYDQWM DSQQCSNFFL WDNLNINVES SSLVGNQDPS MTLGSSALSS  360
SFPSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691445.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_013609805.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A078F9900.0A0A078F990_BRANA; BnaC09g12530D protein
TrEMBLA0A0D3E4F40.0A0A0D3E4F4_BRAOL; Uncharacterized protein
STRINGBra027771.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87602539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.10.0myb domain protein 103